PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G087200.1.p
Common NameGLYMA_02G087200, LOC100820321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 227aa    MW: 25696.9 Da    PI: 4.7251
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G087200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB108.44.5e-34189896
                NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                         +Pi+nv++i  ++lP+nakis da +++q+ ++++i fvt +a ++cq e rk +n++dllwa+ +lGf+dyvepl++++++yr++eg 
  Glyma.02G087200.1.p  1 MPITNVTKITGQILPNNAKISYDAMDMIQQGATKYINFVTRKAKEQCQSEYRKIMNAEDLLWAMKKLGFNDYVEPLTAFVQRYRNIEGS 89
                         8*************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.77E-231106IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.3E-30191IPR009072Histone-fold
PfamPF008083.1E-14164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.8E-112846No hitNo description
PRINTSPR006155.8E-114765No hitNo description
PRINTSPR006155.8E-116684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MPITNVTKIT GQILPNNAKI SYDAMDMIQQ GATKYINFVT RKAKEQCQSE YRKIMNAEDL  60
LWAMKKLGFN DYVEPLTAFV QRYRNIEGSD LFTSHKEPIP HIENNEPRPN PMPTLEILHS  120
PVPPPVHSSK PYFSIDTSHR ELIPHTENNG PSLGLEPNHM PTFEMTPLSP SVHPFESYFS  180
IDPDTNLEIL DPNDINEIYL DEFGVGCSND AFNNVDVSAL FKHDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-22184992NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628426.11e-168PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A0R0KTG71e-168A0A0R0KTG7_SOYBN; Uncharacterized protein
STRINGGLYMA07G29695.15e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.28e-32nuclear factor Y, subunit B6